SCOPe 2.08: Domain d1kuma_: 1kum A:

Lineage for d1kuma_ (1kum A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Glucoamylase, granular starch-binding domain [49460] (1 species)

7. Species Aspergillus niger [TaxId:5061] [49461] (5 PDB entries)

8. Domain d1kuma_: 1kum A: [22525]

Details for d1kuma_

PDB Entry: 1kum

PDB Description: glucoamylase, granular starch-binding domain, nmr, minimized average structure

PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d1kuma_:

Sequence; same for both SEQRES and ATOM records:

>d1kuma_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

Timeline for d1kuma_:

• d1kuma_ first appeared (with stable ids) in SCOP 1.55, called d1kum__
  
• d1kuma_ appears in SCOPe 2.07