Lineage for d1d7fa2 (1d7f A:583-686)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378394Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2378395Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2378428Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2378470Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries)
    Uniprot P05618
  8. 2378473Domain d1d7fa2: 1d7f A:583-686 [22517]
    Other proteins in same PDB: d1d7fa1, d1d7fa3, d1d7fa4, d1d7fb1, d1d7fb3, d1d7fb4
    complexed with ca

Details for d1d7fa2

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1d7fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fa2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOPe Domain Coordinates for d1d7fa2:

Click to download the PDB-style file with coordinates for d1d7fa2.
(The format of our PDB-style files is described here.)

Timeline for d1d7fa2: