Lineage for d1qhpa2 (1qhp A:577-686)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries) 
Domain d1qhpa2: 1qhp A:577-686 [22514]
Other proteins in same PDB: d1qhpa1, d1qhpa3, d1qhpa4
Details for d1qhpa2
PDB Entry: 1qhp (more details), 1.7 Å
PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex
SCOP Domain Sequences for d1qhpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhpa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn
SCOP Domain Coordinates for d1qhpa2:
Click to download the PDB-style file with coordinates for d1qhpa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qhpa2:
- d1qhpa2 appears in SCOP 1.57
- d1qhpa2 appears in the current release, SCOPe 2.08
View in 3D
