Lineage for d1cyg_2 (1cyg 575-680)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106205Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 106206Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 106216Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 106257Species Bacillus stearothermophilus [TaxId:1422] [49456] (1 PDB entry)
  8. 106258Domain d1cyg_2: 1cyg 575-680 [22512]
    Other proteins in same PDB: d1cyg_1, d1cyg_3, d1cyg_4

Details for d1cyg_2

PDB Entry: 1cyg (more details), 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

SCOP Domain Sequences for d1cyg_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyg_2 b.3.1.1 (575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus}
ltndqvsvrfvvnnattnlgqniyivgnvyelgnwdtskaigpmfnqvvysyptwyidvs
vpegktiefkfikkdsqgnvtwesgsnhvyttptnttgkiivdwqn

SCOP Domain Coordinates for d1cyg_2:

Click to download the PDB-style file with coordinates for d1cyg_2.
(The format of our PDB-style files is described here.)

Timeline for d1cyg_2: