SCOP 1.57: Domain d1cyg_2: 1cyg 575-680

Lineage for d1cyg_2 (1cyg 575-680)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [49456] (1 PDB entry)

8. Domain d1cyg_2: 1cyg 575-680 [22512]
   Other proteins in same PDB: d1cyg_1, d1cyg_3, d1cyg_4

Details for d1cyg_2

PDB Entry: 1cyg, 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

SCOP Domain Sequences for d1cyg_2:

Sequence; same for both SEQRES and ATOM records:

>d1cyg_2 b.3.1.1 (575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus}
ltndqvsvrfvvnnattnlgqniyivgnvyelgnwdtskaigpmfnqvvysyptwyidvs
vpegktiefkfikkdsqgnvtwesgsnhvyttptnttgkiivdwqn

Timeline for d1cyg_2:

• d1cyg_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cyg_2 appears in SCOP 1.59
  
• d1cyg_2 appears in the current release, SCOPe 2.08, called d1cyga2