Class b: All beta proteins [48724] (126 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus circulans, different strains [TaxId:1397] [49455] (31 PDB entries) |
Domain d1cxf_2: 1cxf 582-686 [22510] Other proteins in same PDB: d1cxf_1, d1cxf_3, d1cxf_4 complexed with acx, ca, glc, mal; mutant |
PDB Entry: 1cxf (more details), 2.6 Å
SCOP Domain Sequences for d1cxf_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxf_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1cxf_2: