SCOP 1.61: Domain d1cxf_2: 1cxf 582-686

Lineage for d1cxf_2 (1cxf 582-686)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)

8. Domain d1cxf_2: 1cxf 582-686 [22510]
   Other proteins in same PDB: d1cxf_1, d1cxf_3, d1cxf_4

Details for d1cxf_2

PDB Entry: 1cxf, 2.6 Å

PDB Description: complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin

SCOP Domain Sequences for d1cxf_2:

Sequence; same for both SEQRES and ATOM records:

>d1cxf_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1cxf_2:

• d1cxf_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cxf_2 appears in SCOP 1.59
  
• d1cxf_2 appears in SCOP 1.63
  
• d1cxf_2 appears in the current release, SCOPe 2.08, called d1cxfa2