Lineage for d1dtua2 (1dtu A:584-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10512Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries)
  8. 10535Domain d1dtua2: 1dtu A:584-686 [22509]
    Other proteins in same PDB: d1dtua1, d1dtua3, d1dtua4

Details for d1dtua2

PDB Entry: 1dtu (more details), 2.4 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor

SCOP Domain Sequences for d1dtua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtua2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1dtua2:

Click to download the PDB-style file with coordinates for d1dtua2.
(The format of our PDB-style files is described here.)

Timeline for d1dtua2: