![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
![]() | Domain d1dtua2: 1dtu A:584-686 [22509] Other proteins in same PDB: d1dtua1, d1dtua3, d1dtua4 complexed with adh, ca; mutant |
PDB Entry: 1dtu (more details), 2.4 Å
SCOPe Domain Sequences for d1dtua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtua2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]} gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1dtua2: