SCOP 1.73: Domain d2cxga2: 2cxg A:582-686

Lineage for d2cxga2 (2cxg A:582-686)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d2cxga2: 2cxg A:582-686 [22508]
   Other proteins in same PDB: d2cxga1, d2cxga3, d2cxga4
   complexed with aci, ca, glc, gld

Details for d2cxga2

PDB Entry: 2cxg, 2.5 Å

PDB Description: cyclodextrin glycosyltransferase complexed to the inhibitor acarbose

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d2cxga2:

Sequence; same for both SEQRES and ATOM records:

>d2cxga2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d2cxga2:

• d2cxga2 first appeared (with stable ids) in SCOP 1.55, called d2cxg_2
  
• d2cxga2 was called d2cxg_2 in SCOP 1.71
  
• d2cxga2 appears in SCOP 1.75
  
• d2cxga2 appears in the current release, SCOPe 2.08