Lineage for d1cgua2 (1cgu A:580-684)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768633Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2768671Domain d1cgua2: 1cgu A:580-684 [22507]
    Other proteins in same PDB: d1cgua1, d1cgua3, d1cgua4
    complexed with ca

Details for d1cgua2

PDB Entry: 1cgu (more details), 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis
PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOPe Domain Sequences for d1cgua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgua2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

SCOPe Domain Coordinates for d1cgua2:

Click to download the PDB-style file with coordinates for d1cgua2.
(The format of our PDB-style files is described here.)

Timeline for d1cgua2: