Class b: All beta proteins [48724] (149 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
Domain d1cxla2: 1cxl A:584-686 [22498] Other proteins in same PDB: d1cxla1, d1cxla3, d1cxla4 complexed with ca, g4d, glc, glf, mpd; mutant |
PDB Entry: 1cxl (more details), 1.81 Å
SCOP Domain Sequences for d1cxla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxla2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1cxla2: