SCOP 1.73: Domain d1eo5a2: 1eo5 A:584-686

Lineage for d1eo5a2 (1eo5 A:584-686)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1eo5a2: 1eo5 A:584-686 [22497]
   Other proteins in same PDB: d1eo5a1, d1eo5a3, d1eo5a4
   complexed with ca, glc, mpd; mutant

Details for d1eo5a2

PDB Entry: 1eo5, 2 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltoheptaose

PDB Compounds: (A:) protein (cyclodextrin glycosyltransferase)

SCOP Domain Sequences for d1eo5a2:

Sequence; same for both SEQRES and ATOM records:

>d1eo5a2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1eo5a2:

• d1eo5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1eo5a2 appears in SCOP 1.71
  
• d1eo5a2 appears in SCOP 1.75
  
• d1eo5a2 appears in the current release, SCOPe 2.08