SCOPe 2.05: Domain d1d3ca2: 1d3c A:584-686

Lineage for d1d3ca2 (1d3c A:584-686)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1d3ca2: 1d3c A:584-686 [22496]
   Other proteins in same PDB: d1d3ca1, d1d3ca3, d1d3ca4
   complexed with ca, mpd

Details for d1d3ca2

PDB Entry: 1d3c, 1.78 Å

PDB Description: michaelis complex of bacillus circulans strain 251 cyclodextrin glycosyltransferase with gamma-cyclodextrin

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1d3ca2:

Sequence; same for both SEQRES and ATOM records:

>d1d3ca2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1d3ca2:

• d1d3ca2 first appeared (with stable ids) in SCOP 1.55
  
• d1d3ca2 appears in SCOPe 2.04
  
• d1d3ca2 appears in SCOPe 2.06
  
• d1d3ca2 appears in the current release, SCOPe 2.08