Lineage for d1cgya2 (1cgy A:582-686)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378394Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2378395Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2378428Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2378429Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2378449Domain d1cgya2: 1cgy A:582-686 [22492]
    Other proteins in same PDB: d1cgya1, d1cgya3, d1cgya4
    complexed with ca, mal; mutant

Details for d1cgya2

PDB Entry: 1cgy (more details), 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1cgya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgya2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOPe Domain Coordinates for d1cgya2:

Click to download the PDB-style file with coordinates for d1cgya2.
(The format of our PDB-style files is described here.)

Timeline for d1cgya2: