SCOP 1.61: Domain d1cgv_2: 1cgv 582-686

Lineage for d1cgv_2 (1cgv 582-686)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)

8. Domain d1cgv_2: 1cgv 582-686 [22489]
   Other proteins in same PDB: d1cgv_1, d1cgv_3, d1cgv_4

Details for d1cgv_2

PDB Entry: 1cgv, 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgv_2:

Sequence; same for both SEQRES and ATOM records:

>d1cgv_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1cgv_2:

• d1cgv_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cgv_2 appears in SCOP 1.59
  
• d1cgv_2 appears in SCOP 1.63
  
• d1cgv_2 appears in the current release, SCOPe 2.08, called d1cgva2