Lineage for d3cgt_2 (3cgt 582-684)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries) 
Domain d3cgt_2: 3cgt 582-684 [22488]
Other proteins in same PDB: d3cgt_1, d3cgt_3, d3cgt_4
Details for d3cgt_2
PDB Entry: 3cgt (more details), 2.4 Å
PDB Description: structure of cyclodextrin glycosyltransferase complexed with its main product beta-cyclodextrin
SCOP Domain Sequences for d3cgt_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cgt_2 b.3.1.1 (582-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsv
pagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq
SCOP Domain Coordinates for d3cgt_2:
Click to download the PDB-style file with coordinates for d3cgt_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cgt_2:
- d3cgt_2 appears in SCOP 1.57
- d3cgt_2 appears in the current release, SCOPe 2.08, called d3cgta2
View in 3D
