Lineage for d1cxi_2 (1cxi 582-686)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106205Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 106206Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 106216Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 106217Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)
  8. 106224Domain d1cxi_2: 1cxi 582-686 [22487]
    Other proteins in same PDB: d1cxi_1, d1cxi_3, d1cxi_4

Details for d1cxi_2

PDB Entry: 1cxi (more details), 2.2 Å

PDB Description: wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55

SCOP Domain Sequences for d1cxi_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxi_2 b.3.1.1 (582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1cxi_2:

Click to download the PDB-style file with coordinates for d1cxi_2.
(The format of our PDB-style files is described here.)

Timeline for d1cxi_2: