![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
![]() | Domain d1cxea2: 1cxe A:582-686 [22486] Other proteins in same PDB: d1cxea1, d1cxea3, d1cxea4 complexed with ca, mal |
PDB Entry: 1cxe (more details), 2.1 Å
SCOPe Domain Sequences for d1cxea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxea2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]} lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1cxea2: