| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
| Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
| Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
| Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
| Domain d1cgta2: 1cgt A:580-684 [22484] Other proteins in same PDB: d1cgta1, d1cgta3, d1cgta4 complexed with ca |
PDB Entry: 1cgt (more details), 2 Å
SCOPe Domain Sequences for d1cgta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq
Timeline for d1cgta2: