Lineage for d4m61c1 (4m61 C:1-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296805Domain d4m61c1: 4m61 C:1-112 [224831]
    Other proteins in same PDB: d4m61a2, d4m61c2
    automated match to d1dqdl1
    complexed with so4

Details for d4m61c1

PDB Entry: 4m61 (more details), 1.62 Å

PDB Description: Crystal structure of unliganded anti-DNA Fab A52
PDB Compounds: (C:) Fab A52 light chain

SCOPe Domain Sequences for d4m61c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m61c1 b.1.1.0 (C:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nimmtqspsslavsagekvtmsckssqsvlyssnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyychqhlsswtfgggtkleik

SCOPe Domain Coordinates for d4m61c1:

Click to download the PDB-style file with coordinates for d4m61c1.
(The format of our PDB-style files is described here.)

Timeline for d4m61c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m61c2