Lineage for d4m61a2 (4m61 A:113-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763692Domain d4m61a2: 4m61 A:113-219 [224830]
    Other proteins in same PDB: d4m61a1, d4m61c1
    automated match to d1dqdl2
    complexed with so4

Details for d4m61a2

PDB Entry: 4m61 (more details), 1.62 Å

PDB Description: Crystal structure of unliganded anti-DNA Fab A52
PDB Compounds: (A:) Fab A52 light chain

SCOPe Domain Sequences for d4m61a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m61a2 b.1.1.2 (A:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathatstspivksfnrnec

SCOPe Domain Coordinates for d4m61a2:

Click to download the PDB-style file with coordinates for d4m61a2.
(The format of our PDB-style files is described here.)

Timeline for d4m61a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m61a1