SCOPe 2.03: Domain d4m61a2: 4m61 A:113-219

Lineage for d4m61a2 (4m61 A:113-219)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d4m61a2: 4m61 A:113-219 [224830]
   Other proteins in same PDB: d4m61a1, d4m61c1
   automated match to d1dqdl2
   complexed with so4

Details for d4m61a2

PDB Entry: 4m61, 1.62 Å

PDB Description: Crystal structure of unliganded anti-DNA Fab A52

PDB Compounds: (A:) Fab A52 light chain

SCOPe Domain Sequences for d4m61a2:

Sequence; same for both SEQRES and ATOM records:

>d4m61a2 b.1.1.2 (A:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathatstspivksfnrnec

Timeline for d4m61a2:

• d4m61a2 is new in SCOPe 2.03-stable
  
• d4m61a2 appears in SCOPe 2.04
  
• d4m61a2 appears in the current release, SCOPe 2.08