| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4m61a1: 4m61 A:1-112 [224829] Other proteins in same PDB: d4m61a2, d4m61b_, d4m61c2, d4m61d_ automated match to d1dqdl1 complexed with so4 |
PDB Entry: 4m61 (more details), 1.62 Å
SCOPe Domain Sequences for d4m61a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m61a1 b.1.1.0 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nimmtqspsslavsagekvtmsckssqsvlyssnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyychqhlsswtfgggtkleik
Timeline for d4m61a1:
View in 3DDomains from other chains: (mouse over for more information) d4m61b_, d4m61c1, d4m61c2, d4m61d_ |