Lineage for d4m5aa_ (4m5a A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939732Protein automated matches [190420] (8 species)
    not a true protein
  7. 1939756Species Momordica balsamina [TaxId:3672] [189375] (66 PDB entries)
  8. 1939798Domain d4m5aa_: 4m5a A: [224828]
    automated match to d3mrwa_
    complexed with da2, nag

Details for d4m5aa_

PDB Entry: 4m5a (more details), 1.7 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina inhibited by asymmetric dimethyl arginine at 1.70 a resolution
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4m5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m5aa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4m5aa_:

Click to download the PDB-style file with coordinates for d4m5aa_.
(The format of our PDB-style files is described here.)

Timeline for d4m5aa_: