SCOPe 2.08: Domain d4m1nb1: 4m1n B:2-159

Lineage for d4m1nb1 (4m1n B:2-159)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries)

8. Domain d4m1nb1: 4m1n B:2-159 [224811]
   Other proteins in same PDB: d4m1nb2
   automated match to d2grra_
   complexed with na

Details for d4m1nb1

PDB Entry: 4m1n, 1.5 Å

PDB Description: crystal structure of plasmodium falciparum ubiquitin conjugating enzyme ubc9

PDB Compounds: (B:) Ubiquitin conjugating enzyme UBC9

SCOPe Domain Sequences for d4m1nb1:

Sequence; same for both SEQRES and ATOM records:

>d4m1nb1 d.20.1.1 (B:2-159) automated matches {Plasmodium falciparum [TaxId: 36329]}
siakkrlaqeraewrkdhpagfsakyspmsdgkgldimkwickipgkkgglweggeyplt
meftedypskppkckfttvlfhpniypsgtvclsilnededwkpsitikqillgiqdlld
npnpnspaqaepfllyqqdrdsyekkvkkqaiefrpkd

Timeline for d4m1nb1:

• d4m1nb1 first appeared in SCOPe 2.03, called d4m1nb_
  
• d4m1nb1 appears in SCOPe 2.07