Lineage for d4m1ee_ (4m1e E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889180Species Planctomyces limnophilus [TaxId:521674] [226754] (1 PDB entry)
  8. 2889185Domain d4m1ee_: 4m1e E: [224808]
    automated match to d1tcva_
    complexed with 6pc, ade, so4

Details for d4m1ee_

PDB Entry: 4m1e (more details), 1.9 Å

PDB Description: crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364.
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4m1ee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1ee_ c.56.2.0 (E:) automated matches {Planctomyces limnophilus [TaxId: 521674]}
mselksridqatakisqlwqgepavgmilgtglgglaeqieqdiaipysdiphfptstvk
shagrlvcgrlrgipivamegrfhyyegysleqvtfpvrvmkamgvktllvtnaagginp
qldlsdvliiedhinlmpenplrgpndeelgprfpdmshpydcqhmevarqvalelgihc
pkgvfvavsgpnletraeyrmlklmgadvvgmstvpevlvavhaglrvlgfsvvtdlclp
dalepvelnkilevaarggaklarlipeilpri

SCOPe Domain Coordinates for d4m1ee_:

Click to download the PDB-style file with coordinates for d4m1ee_.
(The format of our PDB-style files is described here.)

Timeline for d4m1ee_: