Lineage for d4m0kd_ (4m0k D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863901Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1863902Protein automated matches [190891] (25 species)
    not a true protein
  7. 1864052Species Rhodothermus marinus [TaxId:518766] [226752] (1 PDB entry)
  8. 1864056Domain d4m0kd_: 4m0k D: [224803]
    automated match to d1zn8b_
    complexed with amp, ca

Details for d4m0kd_

PDB Entry: 4m0k (more details), 1.4 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775.
PDB Compounds: (D:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d4m0kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m0kd_ c.61.1.0 (D:) automated matches {Rhodothermus marinus [TaxId: 518766]}
nataletlkqairtvpdfpepgiqfkditpvlghpellrlaieallepfqeqeitkvvgi
esrgfilggmlahhldagfvpvrkkgklpyqtlaesyqleygtdtiemhidaiepgdrvl
ihddviatggtaeatirlveraggevvgcaflieltglqgrkrlpahvpvhtvlql

SCOPe Domain Coordinates for d4m0kd_:

Click to download the PDB-style file with coordinates for d4m0kd_.
(The format of our PDB-style files is described here.)

Timeline for d4m0kd_: