Lineage for d1ci3m1 (1ci3 M:1-169,M:232-249)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55488Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 55489Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 55490Protein Cytochrome f, large domain [49443] (3 species)
  7. 55506Species Phormidium laminosum [TaxId:32059] [49446] (1 PDB entry)
  8. 55507Domain d1ci3m1: 1ci3 M:1-169,M:232-249 [22480]
    Other proteins in same PDB: d1ci3m2

Details for d1ci3m1

PDB Entry: 1ci3 (more details), 1.9 Å

PDB Description: cytochrome f from the b6f complex of phormidium laminosum

SCOP Domain Sequences for d1ci3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci3m1 b.2.6.1 (M:1-169,M:232-249) Cytochrome f, large domain {Phormidium laminosum}
ypfwaqqnyanpreatgrivcanchlaakpaeievpqavlpdsvfkavvkipydhsvqqv
qadgskgplnvgavlmlpegftiapedripeemkeevgpsylfqpyaddkqnivlvgplp
gdeyeeivfpvlspnpatnksvafgkysihlganrgrgqiyptgeksnnXnvggfgqkdt
eivlqspn

SCOP Domain Coordinates for d1ci3m1:

Click to download the PDB-style file with coordinates for d1ci3m1.
(The format of our PDB-style files is described here.)

Timeline for d1ci3m1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ci3m2