Lineage for d1ci3m1 (1ci3 M:1-169,M:232-249)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) 
Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) Protein Cytochrome f, large domain [49443] (5 species)
this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
Species Phormidium laminosum [TaxId:32059] [49446] (1 PDB entry) 
Domain d1ci3m1: 1ci3 M:1-169,M:232-249 [22480]
Other proteins in same PDB: d1ci3m2
complexed with hec, zn
Details for d1ci3m1
PDB Entry: 1ci3 (more details), 1.9 Å
PDB Description: cytochrome f from the b6f complex of phormidium laminosum
PDB Compounds: (M:) protein (cytochrome f)SCOPe Domain Sequences for d1ci3m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci3m1 b.2.6.1 (M:1-169,M:232-249) Cytochrome f, large domain {Phormidium laminosum [TaxId: 32059]}
ypfwaqqnyanpreatgrivcanchlaakpaeievpqavlpdsvfkavvkipydhsvqqv
qadgskgplnvgavlmlpegftiapedripeemkeevgpsylfqpyaddkqnivlvgplp
gdeyeeivfpvlspnpatnksvafgkysihlganrgrgqiyptgeksnnXnvggfgqkdt
eivlqspn
SCOPe Domain Coordinates for d1ci3m1:
Click to download the PDB-style file with coordinates for d1ci3m1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ci3m1:
- d1ci3m1 first appeared (with stable ids) in SCOP 1.55
- d1ci3m1 appears in SCOPe 2.07
View in 3D
