Lineage for d1ci3m1 (1ci3 M:1-169,M:232-249)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768468Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2768469Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2768470Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2768493Species Phormidium laminosum [TaxId:32059] [49446] (1 PDB entry)
  8. 2768494Domain d1ci3m1: 1ci3 M:1-169,M:232-249 [22480]
    Other proteins in same PDB: d1ci3m2
    complexed with hec, zn

Details for d1ci3m1

PDB Entry: 1ci3 (more details), 1.9 Å

PDB Description: cytochrome f from the b6f complex of phormidium laminosum
PDB Compounds: (M:) protein (cytochrome f)

SCOPe Domain Sequences for d1ci3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci3m1 b.2.6.1 (M:1-169,M:232-249) Cytochrome f, large domain {Phormidium laminosum [TaxId: 32059]}
ypfwaqqnyanpreatgrivcanchlaakpaeievpqavlpdsvfkavvkipydhsvqqv
qadgskgplnvgavlmlpegftiapedripeemkeevgpsylfqpyaddkqnivlvgplp
gdeyeeivfpvlspnpatnksvafgkysihlganrgrgqiyptgeksnnXnvggfgqkdt
eivlqspn

SCOPe Domain Coordinates for d1ci3m1:

Click to download the PDB-style file with coordinates for d1ci3m1.
(The format of our PDB-style files is described here.)

Timeline for d1ci3m1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ci3m2