Lineage for d4m0ga1 (4m0g A:1-429)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2113946Species Bacillus anthracis [TaxId:261594] [224889] (2 PDB entries)
  8. 2113949Domain d4m0ga1: 4m0g A:1-429 [224798]
    Other proteins in same PDB: d4m0ga2
    automated match to d3r7ta_
    complexed with cl

Details for d4m0ga1

PDB Entry: 4m0g (more details), 2.15 Å

PDB Description: The crystal structure of an adenylosuccinate synthetase from Bacillus anthracis str. Ames Ancestor.
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d4m0ga1:

Sequence, based on SEQRES records: (download)

>d4m0ga1 c.37.1.0 (A:1-429) automated matches {Bacillus anthracis [TaxId: 261594]}
mssvvvvgtqwgdegkgkitdflsehaevvaryqggnnaghtivfggvkyklhlipsgif
ykekicvignglvvdpkalleelkylhdrgvstdnlrvsnrahvilpyhlkqdeleeask
gdnkigttkkgigpaymdkaarigirmadlldreafkekleqnlaqknrlfekmydtegf
svdeifeeyfeygqqiaqyvcdtsvvlndaldnnhrvlfegaqgvmldidhgtypfvtss
npiaggvtvgtgvgpakvtrvvgvckaytsrvgdgpfptelhdeighqirevgreygttt
grprrvgwfdsvvvrharrvsgltdlslnsidvltgiptlkicvaykcdgkvidevpanl
nilakcepvceelpgwteditgvrsldelpenarkyvervseltgiqlsmfsvgpdrnqt
nivrnvyea

Sequence, based on observed residues (ATOM records): (download)

>d4m0ga1 c.37.1.0 (A:1-429) automated matches {Bacillus anthracis [TaxId: 261594]}
mssvvvvgtqwgdegkgkitdflsehaevvaryqggnnghtivfkyklhlipsgifykek
icvignglvvdpkalleelkylhdrgvstdnlrvsnrahvilpyhlkqdeleeaskgdtk
kgigpaymdkaarigirmadlldreafkekleqnlaqknrlfekmydtegfsvdeifeey
feygqqiaqyvcdtsvvlndaldnnhrvlfegaqgvmldidhgtypfvtssnpiaggvtv
gtgvgpakvtrvvgvckaytsrvgdgpfptelhdeighqirevgreygtttgrprrvgwf
dsvvvrharrvsgltdlslnsidvltgiptlkicvaykcdgkvidevpanlnilakcepv
ceelpgwteditgvrsldelpenarkyvervseltgiqlsmfsvgpdrnqtnivrnvyea

SCOPe Domain Coordinates for d4m0ga1:

Click to download the PDB-style file with coordinates for d4m0ga1.
(The format of our PDB-style files is described here.)

Timeline for d4m0ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m0ga2
View in 3D
Domains from other chains:
(mouse over for more information)
d4m0gb_