SCOPe 2.08: Domain d4lzab_: 4lza B:

Lineage for d4lzab_ (4lza B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Thermoanaerobacter pseudethanolicus [TaxId:340099] [224903] (1 PDB entry)

8. Domain d4lzab_: 4lza B: [224797]
   automated match to d1zn8b_
   complexed with cl

Details for d4lzab_

PDB Entry: 4lza, 1.84 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700.

PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d4lzab_:

Sequence; same for both SEQRES and ATOM records:

>d4lzab_ c.61.1.0 (B:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]}
tleeikmmireipdfpkkgikfkditpvlkdakafnysiemlakalegrkfdliaapear
gflfgaplayrlgvgfvpvrkpgklpaetlsyeyeleygtdsleihkdavlegqrvvivd
dllatggtiyasaklveslggivdsiiflteltfldgrkkldgydiislikf

Timeline for d4lzab_:

• d4lzab_ first appeared in SCOPe 2.03
  
• d4lzab_ appears in SCOPe 2.07