Lineage for d4lzaa_ (4lza A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892115Species Thermoanaerobacter pseudethanolicus [TaxId:340099] [224903] (1 PDB entry)
  8. 2892116Domain d4lzaa_: 4lza A: [224796]
    automated match to d1zn8b_
    complexed with cl

Details for d4lzaa_

PDB Entry: 4lza (more details), 1.84 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700.
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d4lzaa_:

Sequence, based on SEQRES records: (download)

>d4lzaa_ c.61.1.0 (A:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]}
tleeikmmireipdfpkkgikfkditpvlkdakafnysiemlakalegrkfdliaapear
gflfgaplayrlgvgfvpvrkpgklpaetlsyeyeleygtdsleihkdavlegqrvvivd
dllatggtiyasaklveslggivdsiiflteltfldgrkkldgydiislikf

Sequence, based on observed residues (ATOM records): (download)

>d4lzaa_ c.61.1.0 (A:) automated matches {Thermoanaerobacter pseudethanolicus [TaxId: 340099]}
tleeikmmireipdfpkkgikfkditpvlkdakafnysiemlakalegrkfdliaapear
gflfgaplayrlgvgfvpvrkpgklpaetlsyeyetdsleihkdavlegqrvvivddlla
tggtiyasaklveslggivdsiiflteltfldgrkkldgydiislikf

SCOPe Domain Coordinates for d4lzaa_:

Click to download the PDB-style file with coordinates for d4lzaa_.
(The format of our PDB-style files is described here.)

Timeline for d4lzaa_: