SCOPe 2.03: Domain d4lyyc_: 4lyy C:

Lineage for d4lyyc_ (4lyy C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (18 species)
   not a true protein

7. Species Shewanella pealeana [TaxId:398579] [226751] (1 PDB entry)

8. Domain d4lyyc_: 4lyy C: [224793]
   automated match to d2vfaa_
   complexed with po4

Details for d4lyyc_

PDB Entry: 4lyy, 1.86 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.

PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4lyyc_:

Sequence, based on SEQRES records:

>d4lyyc_ c.61.1.0 (C:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssygnemsssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepks
lalctlldkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvv

Sequence, based on observed residues (ATOM records):

>d4lyyc_ c.61.1.0 (C:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepkslalctlld
kperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvv

Timeline for d4lyyc_:

• d4lyyc_ is new in SCOPe 2.03-stable
  
• d4lyyc_ appears in SCOPe 2.04
  
• d4lyyc_ appears in the current release, SCOPe 2.08