![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Shewanella pealeana [TaxId:398579] [226751] (1 PDB entry) |
![]() | Domain d4lyyc_: 4lyy C: [224793] Other proteins in same PDB: d4lyya2 automated match to d2vfaa_ complexed with po4 |
PDB Entry: 4lyy (more details), 1.86 Å
SCOPe Domain Sequences for d4lyyc_:
Sequence, based on SEQRES records: (download)
>d4lyyc_ c.61.1.0 (C:) automated matches {Shewanella pealeana [TaxId: 398579]} khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei dfmsvssygnemsssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepks lalctlldkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvv
>d4lyyc_ c.61.1.0 (C:) automated matches {Shewanella pealeana [TaxId: 398579]} khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei dfmsvssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepkslalctlld kperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvv
Timeline for d4lyyc_:
![]() Domains from other chains: (mouse over for more information) d4lyya1, d4lyya2, d4lyyb_, d4lyyd_ |