Lineage for d4lyyc_ (4lyy C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892100Species Shewanella pealeana [TaxId:398579] [226751] (1 PDB entry)
  8. 2892103Domain d4lyyc_: 4lyy C: [224793]
    Other proteins in same PDB: d4lyya2
    automated match to d2vfaa_
    complexed with po4

Details for d4lyyc_

PDB Entry: 4lyy (more details), 1.86 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.
PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4lyyc_:

Sequence, based on SEQRES records: (download)

>d4lyyc_ c.61.1.0 (C:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssygnemsssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepks
lalctlldkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvv

Sequence, based on observed residues (ATOM records): (download)

>d4lyyc_ c.61.1.0 (C:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepkslalctlld
kperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvv

SCOPe Domain Coordinates for d4lyyc_:

Click to download the PDB-style file with coordinates for d4lyyc_.
(The format of our PDB-style files is described here.)

Timeline for d4lyyc_: