SCOPe 2.07: Domain d4lyya1: 4lyy A:1-175

Lineage for d4lyya1 (4lyy A:1-175)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (33 species)
   not a true protein

7. Species Shewanella pealeana [TaxId:398579] [226751] (1 PDB entry)

8. Domain d4lyya1: 4lyy A:1-175 [224791]
   Other proteins in same PDB: d4lyya2
   automated match to d2vfaa_
   complexed with po4

Details for d4lyya1

PDB Entry: 4lyy, 1.86 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.

PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4lyya1:

Sequence, based on SEQRES records:

>d4lyya1 c.61.1.0 (A:1-175) automated matches {Shewanella pealeana [TaxId: 398579]}
mkhttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghve
idfmsvssygnemsssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepk
slalctlldkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvvpl

Sequence, based on observed residues (ATOM records):

>d4lyya1 c.61.1.0 (A:1-175) automated matches {Shewanella pealeana [TaxId: 398579]}
mkhttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghve
idfmsvssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepkslalctll
dkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvvpl

Timeline for d4lyya1:

• d4lyya1 first appeared in SCOPe 2.03, called d4lyya_
  
• d4lyya1 appears in SCOPe 2.06