Lineage for d1e2zc1 (1e2z C:1-168,C:233-251)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 105991Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 106171Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 106172Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 106173Protein Cytochrome f, large domain [49443] (3 species)
  7. 106174Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (5 PDB entries)
  8. 106188Domain d1e2zc1: 1e2z C:1-168,C:233-251 [22479]
    Other proteins in same PDB: d1e2za2, d1e2zb2, d1e2zc2

Details for d1e2zc1

PDB Entry: 1e2z (more details), 2.5 Å

PDB Description: q158l mutant of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1e2zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2zc1 b.2.6.1 (C:1-168,C:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrglvypdgkksnnXnvggfgqaete
ivlqnpar

SCOP Domain Coordinates for d1e2zc1:

Click to download the PDB-style file with coordinates for d1e2zc1.
(The format of our PDB-style files is described here.)

Timeline for d1e2zc1: