Lineage for d4lw4b_ (4lw4 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867504Species Escherichia coli K-12 [TaxId:83333] [226746] (2 PDB entries)
  8. 1867509Domain d4lw4b_: 4lw4 B: [224773]
    Other proteins in same PDB: d4lw4c_, d4lw4d_
    automated match to d1jf9a_
    complexed with plp

Details for d4lw4b_

PDB Entry: 4lw4 (more details), 2.01 Å

PDB Description: structural changes during cysteine desulfurase csda and sulfur- acceptor csde interactions provide insight into the trans- persulfuration
PDB Compounds: (B:) Cysteine sulfinate desulfinase

SCOPe Domain Sequences for d4lw4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lw4b_ c.67.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqpl
laelgvtgtlrasfapyntksdvdalvnavdralellv

SCOPe Domain Coordinates for d4lw4b_:

Click to download the PDB-style file with coordinates for d4lw4b_.
(The format of our PDB-style files is described here.)

Timeline for d4lw4b_: