SCOPe 2.08: Domain d4lw2b1: 4lw2 B:3-400

Lineage for d4lw2b1 (4lw2 B:3-400)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226746] (6 PDB entries)

8. Domain d4lw2b1: 4lw2 B:3-400 [224770]
   Other proteins in same PDB: d4lw2a2, d4lw2b2
   automated match to d1jf9a_
   complexed with gol, plp

Details for d4lw2b1

PDB Entry: 4lw2, 1.8 Å

PDB Description: structural changes during cysteine desulfurase csda and sulfur- acceptor csde interactions provide insight into the trans- persulfuration

PDB Compounds: (B:) Cysteine sulfinate desulfinase

SCOPe Domain Sequences for d4lw2b1:

Sequence; same for both SEQRES and ATOM records:

>d4lw2b1 c.67.1.0 (B:3-400) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrlt
aryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehhan
lvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlara
itfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygkselleam
spwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaeswsr
slatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqpl
laelgvtgtlrasfapyntksdvdalvnavdralellv

Timeline for d4lw2b1:

• d4lw2b1 first appeared in SCOPe 2.03, called d4lw2b_
  
• d4lw2b1 appears in SCOPe 2.07