SCOPe 2.08: Domain d4lvta_: 4lvt A:

Lineage for d4lvta_ (4lvt A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries)

8. Domain d4lvta_: 4lvt A: [224767]
   automated match to d4aq3b_
   complexed with 1xj

Details for d4lvta_

PDB Entry: 4lvt, 2.05 Å

PDB Description: bcl_2-navitoclax (abt-263) complex

PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d4lvta_:

Sequence, based on SEQRES records:

>d4lvta_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagddfsrryr
rdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremspl
vdnialwmteylnrhlhtwiqdnggwdafvelygp

Sequence, based on observed residues (ATOM records):

>d4lvta_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdasevvhltlrqagddfsrryrrdfaemssqlhltpft
argrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteylnrhl
htwiqdnggwdafvelygp

Timeline for d4lvta_:

• d4lvta_ first appeared in SCOPe 2.03
  
• d4lvta_ appears in SCOPe 2.07