Lineage for d4lt9a1 (4lt9 A:2-256)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079697Protein automated matches [190053] (9 species)
    not a true protein
  7. 2079698Species Artificial gene [TaxId:32630] [188991] (9 PDB entries)
  8. 2079702Domain d4lt9a1: 4lt9 A:2-256 [224754]
    Other proteins in same PDB: d4lt9a2
    automated match to d4a2ra_

Details for d4lt9a1

PDB Entry: 4lt9 (more details), 2.15 Å

PDB Description: Crystal Structure of Engineered Protein, Northeast Structural Genomics Consortium Target OR404
PDB Compounds: (A:) Engineered Protein OR404

SCOPe Domain Sequences for d4lt9a1:

Sequence, based on SEQRES records: (download)

>d4lt9a1 c.1.2.4 (A:2-256) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvhasrqrpiislnerilefnksnitaiiayytrkspsgld
verdpieyakfmeryavglsikteekyfngsyemlrkiassvsipilmndfivkesqidd
aynlgadtvlliasiltereleslleyarsygmeplilindendldialrigarfisifs
vdksklsstggysssysinkenqrklismipsnvvkvaatfkvserneieelrklgvnaf
lissslmrnpekike

Sequence, based on observed residues (ATOM records): (download)

>d4lt9a1 c.1.2.4 (A:2-256) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvhasrqrpiislnerilefnksnitaiiayytrkspsgld
verdpieyakfmeryavglsikteekyfngsyemlrkiassvsipilmndfivkesqidd
aynlgadtvlliasiltereleslleyarsygmeplilindendldialrigarfisifs
vdkskssysinkenqrklismipsnvvkvaatfkvserneieelrklgvnaflissslmr
npekike

SCOPe Domain Coordinates for d4lt9a1:

Click to download the PDB-style file with coordinates for d4lt9a1.
(The format of our PDB-style files is described here.)

Timeline for d4lt9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lt9a2