Lineage for d4lqwc_ (4lqw C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717905Domain d4lqwc_: 4lqw C: [224747]
    Other proteins in same PDB: d4lqwa1, d4lqwa2, d4lqwb1, d4lqwb2
    automated match to d1m9cc_

Details for d4lqwc_

PDB Entry: 4lqw (more details), 1.95 Å

PDB Description: Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin
PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d4lqwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lqwc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d4lqwc_:

Click to download the PDB-style file with coordinates for d4lqwc_.
(The format of our PDB-style files is described here.)

Timeline for d4lqwc_: