Class b: All beta proteins [48724] (177 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186915] (20 PDB entries) |
Domain d4lqwb1: 4lqw B:-3-164 [224746] Other proteins in same PDB: d4lqwa2, d4lqwb2, d4lqwc_, d4lqwd_ automated match to d1qoia_ |
PDB Entry: 4lqw (more details), 1.95 Å
SCOPe Domain Sequences for d4lqwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lqwb1 b.62.1.1 (B:-3-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} elsketnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrv ipdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitl kkaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi
Timeline for d4lqwb1:
View in 3D Domains from other chains: (mouse over for more information) d4lqwa1, d4lqwa2, d4lqwc_, d4lqwd_ |