SCOPe 2.06: Domain d4lqwb1: 4lqw B:-3-164

Lineage for d4lqwb1 (4lqw B:-3-164)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (20 PDB entries)

8. Domain d4lqwb1: 4lqw B:-3-164 [224746]
   Other proteins in same PDB: d4lqwa2, d4lqwb2, d4lqwc_, d4lqwd_
   automated match to d1qoia_

Details for d4lqwb1

PDB Entry: 4lqw, 1.95 Å

PDB Description: Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin

PDB Compounds: (B:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4lqwb1:

Sequence; same for both SEQRES and ATOM records:

>d4lqwb1 b.62.1.1 (B:-3-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elsketnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrv
ipdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitl
kkaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

Timeline for d4lqwb1:

• d4lqwb1 first appeared in SCOPe 2.03, called d4lqwb_
  
• d4lqwb1 was called d4lqwb_ in SCOPe 2.05
  
• d4lqwb1 appears in SCOPe 2.07
  
• d4lqwb1 appears in the current release, SCOPe 2.08