Lineage for d4lqwb1 (4lqw B:-3-164)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2807019Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)
  8. 2807036Domain d4lqwb1: 4lqw B:-3-164 [224746]
    Other proteins in same PDB: d4lqwa2, d4lqwb2, d4lqwc_, d4lqwd_
    automated match to d1qoia_

Details for d4lqwb1

PDB Entry: 4lqw (more details), 1.95 Å

PDB Description: Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin
PDB Compounds: (B:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4lqwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lqwb1 b.62.1.1 (B:-3-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elsketnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrv
ipdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitl
kkaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

SCOPe Domain Coordinates for d4lqwb1:

Click to download the PDB-style file with coordinates for d4lqwb1.
(The format of our PDB-style files is described here.)

Timeline for d4lqwb1: