SCOPe 2.05: Domain d4lqwa_: 4lqw A:

Lineage for d4lqwa_ (4lqw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)

8. Domain d4lqwa_: 4lqw A: [224745]
   Other proteins in same PDB: d4lqwc_, d4lqwd_
   automated match to d1qoia_

Details for d4lqwa_

PDB Entry: 4lqw, 1.95 Å

PDB Description: Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin

PDB Compounds: (A:) E3 SUMO-protein ligase RanBP2

SCOPe Domain Sequences for d4lqwa_:

Sequence; same for both SEQRES and ATOM records:

>d4lqwa_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
melsketnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhr
vipdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvit
lkkaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi

Timeline for d4lqwa_:

• d4lqwa_ first appeared in SCOPe 2.03
  
• d4lqwa_ appears in SCOPe 2.04
  
• d4lqwa_ is called d4lqwa1 in SCOPe 2.06
  
• d4lqwa_ appears in the current release, SCOPe 2.08, called d4lqwa1