![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein automated matches [190077] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries) |
![]() | Domain d4lqwa1: 4lqw A:-3-164 [224745] Other proteins in same PDB: d4lqwa2, d4lqwb2, d4lqwc_, d4lqwd_ automated match to d1qoia_ |
PDB Entry: 4lqw (more details), 1.95 Å
SCOPe Domain Sequences for d4lqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lqwa1 b.62.1.1 (A:-3-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} elsketnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrv ipdfvcqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitl kkaehldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi
Timeline for d4lqwa1:
![]() Domains from other chains: (mouse over for more information) d4lqwb1, d4lqwb2, d4lqwc_, d4lqwd_ |