Lineage for d4loma2 (4lom A:96-200)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177072Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2177073Protein automated matches [190826] (17 species)
    not a true protein
  7. 2177161Species Mycobacterium tuberculosis [TaxId:83332] [225380] (3 PDB entries)
  8. 2177169Domain d4loma2: 4lom A:96-200 [224732]
    automated match to d2f1da2
    complexed with iyp, mn

Details for d4loma2

PDB Entry: 4lom (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis hisb in complex with its substrate
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d4loma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4loma2 d.14.1.0 (A:96-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
girrfgdafipmdetlahaavdlsgrpycvhtgepdhlqhttiagssvpyhtvinrhvfe
slaanarialhvrvlygrdphhiteaqykavaralrqavepdprv

SCOPe Domain Coordinates for d4loma2:

Click to download the PDB-style file with coordinates for d4loma2.
(The format of our PDB-style files is described here.)

Timeline for d4loma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4loma1