![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225380] (3 PDB entries) |
![]() | Domain d4loma1: 4lom A:10-95 [224731] automated match to d2f1da1 complexed with iyp, mn |
PDB Entry: 4lom (more details), 2.1 Å
SCOPe Domain Sequences for d4loma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4loma1 d.14.1.0 (A:10-95) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} srrarierrtresdivieldldgtgqvavdtgvpfydhmltalgshasfdltvratgdve ieahhtiedtaialgtalgqalgdkr
Timeline for d4loma1: