| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) ![]() |
| Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) |
| Protein Cytochrome f, large domain [49443] (5 species) this domain is interrupted by a small domain which is barrel-sandwich hybrid fold |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries) |
| Domain d1cfmc1: 1cfm C:1-168,C:233-251 [22473] Other proteins in same PDB: d1cfma2, d1cfmb2, d1cfmc2 complexed with hem |
PDB Entry: 1cfm (more details), 2 Å
SCOPe Domain Sequences for d1cfmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfmc1 b.2.6.1 (C:1-168,C:233-251) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar
Timeline for d1cfmc1:
View in 3DDomains from other chains: (mouse over for more information) d1cfma1, d1cfma2, d1cfmb1, d1cfmb2 |