Lineage for d4lnya_ (4lny A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337745Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1337868Protein automated matches [190053] (8 species)
    not a true protein
  7. 1337869Species Artificial gene [TaxId:32630] [188991] (7 PDB entries)
  8. 1337871Domain d4lnya_: 4lny A: [224721]
    automated match to d3tc7a_
    complexed with cd, cl

Details for d4lnya_

PDB Entry: 4lny (more details), 1.93 Å

PDB Description: Crystal Structure of Engineered Protein, Northeast Structural Genomics Consortium Target OR422
PDB Compounds: (A:) Engineered Protein OR422

SCOPe Domain Sequences for d4lnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnya_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiaeykrkdpsgld
verdpieyakfmeryavglfisteekyfngsyetlrkiassvsipilmydfivkesqidd
aynlgadtvalivkiltereleslleyarsygmepliiindendldialrigarfigiaa
rdwetgeinkenqrklismipsnvvkvakegiserneieelrklgvnafvtasgslmrnp
ekikelie

SCOPe Domain Coordinates for d4lnya_:

Click to download the PDB-style file with coordinates for d4lnya_.
(The format of our PDB-style files is described here.)

Timeline for d4lnya_: